PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_Sca008577G01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 262aa    MW: 30094.2 Da    PI: 5.1952
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_Sca008577G01genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.73.7e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l  +++++G  +W+  +++ g+ R++k+c++rw +yl
  Gh_Sca008577G01 14 KGAWSPEEDHKLRSYIEKFGHWNWRELPKYAGLERCGKSCRLRWMNYL 61
                     79******************99************************97 PP

2Myb_DNA-binding52.98.5e-1768109245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      g+ T+eEd l+ ++++++G++ W+ Ia++++ gRt++++k++w+
  Gh_Sca008577G01  68 GNYTEEEDALIMKLHQEYGNR-WSMIAARLP-GRTDNEIKNHWH 109
                      789******************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.679961IPR017930Myb domain
SuperFamilySSF466895.99E-3111108IPR009057Homeodomain-like
SMARTSM007172.1E-101363IPR001005SANT/Myb domain
PfamPF002493.4E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-231568IPR009057Homeodomain-like
CDDcd001675.64E-91661No hitNo description
PROSITE profilePS5129426.29462116IPR017930Myb domain
SMARTSM007178.0E-1666114IPR001005SANT/Myb domain
PfamPF002494.9E-1568109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-2669114IPR009057Homeodomain-like
CDDcd001674.44E-1269109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MVRAPFYDKN GMKKGAWSPE EDHKLRSYIE KFGHWNWREL PKYAGLERCG KSCRLRWMNY  60
LRPDVKHGNY TEEEDALIMK LHQEYGNRWS MIAARLPGRT DNEIKNHWHA RLKTRAKRNQ  120
TSSTDSQSES AHSWEGEGES MVFDTPPNMI LESSRLSPTT SSSTEFSSFS PPPIDSGYTS  180
NLNLSGVAVE PPSYSSTEIY EDQRGGGDFW SEPFVADNVY NQDGYPSSSL GRGGFDMPLP  240
YDHFYDDDSP DLLLYQMMQG WV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-27121165108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5787165e-66JX578716.1 Gossypium hirsutum clone NBRI_GE10796 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438142.10.0PREDICTED: myb-related protein Myb4-like
RefseqXP_012438143.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0D2U3M90.0A0A0D2U3M9_G
STRINGPOPTR_0019s14130.18e-86(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17768510
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.18e-55myb domain protein 63